PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1647_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 319aa    MW: 35497.1 Da    PI: 9.8748
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1647_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-134892147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  cra_locus_1647_iso_5_len_1543_ver_3 48 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 92
                                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-174298IPR009057Homeodomain-like
PROSITE profilePS5129415.4084397IPR017930Myb domain
TIGRFAMsTIGR015571.4E-184695IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-64698IPR009057Homeodomain-like
SMARTSM007175.3E-114795IPR001005SANT/Myb domain
PfamPF002492.6E-114892IPR001005SANT/Myb domain
CDDcd001671.89E-85093No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGLPGLHSLQ PVTNSNIAGQ NSNNSGSGVA ADDPSKKVRK PYTITKSRES WTEQEHDKFL  60
EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ KYFLKVQKSG TTEHVPPPRP KRKAAHPYPQ  120
KAPKNAVHQV GGLVPSSSSL VEPTYVIRPD SLSVPRNSFS NAALSPWTYN SAPTATMSHM  180
SKDDVGLGGS IVVHNNSSSS NESTPRIWPL NESNDQLKEK NKLPARMIPD FSQVYSFIGS  240
IFDPSAKGDH LQRLRKMDPI NVETVLMLMR NLSVNLMSPE FEDHRRVIVS YSVGREEDKE  300
NVPNDIIKSI NRGNADICM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776267.11e-136PREDICTED: protein REVEILLE 6 isoform X3
SwissprotQ8H0W31e-105RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A068UME01e-161A0A068UME0_COFCA; Uncharacterized protein
STRINGVIT_15s0046g02260.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478